PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_36879.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 130aa    MW: 14249.1 Da    PI: 7.407
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_36879.6genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB147.13.8e-461771793
         NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                  mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl+kyre 
  MLOC_36879.6  1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLQKYREG 77
                  9**************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.58E-31193IPR009072Histone-fold
PfamPF008081.3E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.8E-42186IPR009072Histone-fold
PRINTSPR006154.6E-231937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.6E-233856No hitNo description
PRINTSPR006154.6E-235775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF  60
EEYIEPLKVY LQKYREGDSK LAGKSGDVSV KKDALGPHGG ASAQGMGQQV AYNPGMVYMQ  120
PQYHNGDISN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-401761893NF-YB
4awl_B3e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3579820.0AK357982.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1066F22.
GenBankAK3674780.0AK367478.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2057P16.
GenBankAK3707270.0AK370727.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2116A18.
GenBankJF7646040.0JF764604.1 Hordeum vulgare NF-YB5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568278.17e-82PREDICTED: nuclear transcription factor Y subunit B
SwissprotP252097e-79NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLM0VSI35e-94M0VSI3_HORVD; Uncharacterized protein
STRINGMLOC_36879.41e-91(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.78e-54nuclear factor Y, subunit B1